PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen09g006110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 504aa    MW: 56025.5 Da    PI: 7.2238
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen09g006110.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092993312254
                       SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       ++yp+ +++  LAk++gL+ +qV++WF N R +
  Sopen09g006110.1 299 HPYPTDTDKVMLAKQTGLSRNQVSNWFINARVR 331
                       89*****************************88 PP

2BELL103.81.2e-33171239472
              BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       +  kkk++L+s+l+eV+++Ykqy+eqlq+v++sFe vaglg+a+p++++A k++S+hF+cLkdai++q+
  Sopen09g006110.1 171 QFGKKKSRLISMLDEVYHKYKQYHEQLQMVVASFESVAGLGNAAPFANIAIKTMSKHFKCLKDAIIDQL 239
                       5679**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-41116237IPR006563POX domain
PfamPF075263.5E-34121235IPR006563POX domain
PROSITE profilePS5007111.953272335IPR001356Homeobox domain
CDDcd000862.76E-12275336No hitNo description
SMARTSM003898.6E-10275339IPR001356Homeobox domain
SuperFamilySSF466893.72E-17277341IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27278339IPR009057Homeodomain-like
PfamPF059201.1E-18292331IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDKLR VLLDENNNSN CQIPPLYDPS IVLSSDLSIF QEINGNPFLY  60
TSQIPRFLDH NNNNSNSNSN GQGNLSLSLS SLHNNDLSSS KSITTTTSCV PFGPFTGYSL  120
ILKRSKFLKP AQILLDELCH VTKGIYVDDS NDDASNLMMD TPQGFTNGDE QFGKKKSRLI  180
SMLDEVYHKY KQYHEQLQMV VASFESVAGL GNAAPFANIA IKTMSKHFKC LKDAIIDQLQ  240
FTTSKSSHGQ INCERGVGIS GKGIYCQRQE TQPVWRPQRG LPERAVTVLR AWLFDHFLHP  300
YPTDTDKVML AKQTGLSRNQ VSNWFINARV RLWKPMVEEI HMLETREGNN KSSSHREGPN  360
NNNNNNIDNN NPIEHFPMSN SNACESKTPS TSTSRLEDLP SKRTRNELTN IPNNIGGIAD  420
SINLSYGNLS TGVGGGVSLT LGLHQNSGNI GLSEPFPMNA ARRFGIDNNT SSERVIFGGF  480
DEQNGQFGRN NSMVGGQFLH DFGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-16281338158Homeobox protein Meis1
4xrs_B7e-16281338158Homeobox protein Meis1
5bng_A6e-16281339159Homeobox protein Meis2
5bng_B6e-16281339159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015086249.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-106BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLK4CRG40.0K4CRG4_SOLLC; Uncharacterized protein
STRINGSolyc09g011380.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.17e-95TALE family protein